PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00142773001
Common NameGSBRNA2T00142773001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 527aa    MW: 59691.6 Da    PI: 7.4196
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00142773001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like75.57.3e-2437791355
              G2-like 13 rFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         rFv+av+qLGG++kAtP+ti+++m+vkgLtl+h+kSHLQk+Rl
  GSBRNA2T00142773001 37 RFVDAVSQLGGPDKATPRTIMRTMGVKGLTLYHLKSHLQKFRL 79
                         8*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.11E-83680IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-163680IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.9E-213781IPR009057Homeodomain-like
PfamPF143799.0E-25145191IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PROSITE profilePS5022213.649349384IPR002048EF-hand domain
Gene3DG3DSA:1.10.238.104.9E-23351513IPR011992EF-hand domain pair
SuperFamilySSF474734.58E-26351521IPR011992EF-hand domain pair
SMARTSM000541.2E-4353381IPR002048EF-hand domain
PfamPF134991.7E-7353413IPR002048EF-hand domain
CDDcd000512.54E-9354415No hitNo description
PROSITE patternPS000180362374IPR018247EF-Hand 1, calcium-binding site
PROSITE profilePS502225.587399421IPR002048EF-hand domain
PROSITE profilePS502228.014443478IPR002048EF-hand domain
SMARTSM0005420447475IPR002048EF-hand domain
PROSITE profilePS502225.615482517IPR002048EF-hand domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005509Molecular Functioncalcium ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MYSLPLDGGE YHGPLDGTDL PGDACLVLTT DPKPRLRFVD AVSQLGGPDK ATPRTIMRTM  60
GVKGLTLYHL KSHLQKFRLG RQACKESTTD NSKDGNTCLL FLCWRELAGH RFIFFIIIEN  120
GSARAERRIT VLQNLFTCMQ TRGYQVTEAL RAQMEVQRRL HKQLEVQRRL QLRIEAQGKY  180
LHSILEKACK AFDEQAATFA GLEAAREELS ELAIRVSNST RVPFFDATKM MMMPSLSELS  240
VAIDHKTNIT TNCSVESPLT SNTNGSSISA ASMKKRHRDM GLGYEAGWPN SSTIGSMLCC  300
CVNSESNKKY AELDAKLERK MVERRRYYPG HRSLKSMDSI IMMFPKLREG LRNIRNVFES  360
YDQDRNGTID MEELKKCLEE LKLMSLSEEE VKGLYGWCDV DGSKGIQFNE FIVLLCLIYL  420
LAKPSAESNV EESIELGPKL VESIFDPILE VFLFLDKDGK GKLNKADVIK TLNNEDYPLE  480
RSPKHVTNMR FEEMDWGRKG KVGFREFLFA FMSWVGIDDA DGYMSS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.134791e-127seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00142773001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0503551e-132AY050355.1 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, complete cds.
GenBankAY0884281e-132AY088428.1 Arabidopsis thaliana clone 6626 mRNA, complete sequence.
GenBankAY0940461e-132AY094046.1 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597765.11e-171PREDICTED: LOW QUALITY PROTEIN: myb family transcription factor APL
TrEMBLA0A078D7V00.0A0A078D7V0_BRANA; BnaC07g07340D protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM740822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-131G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]